Shop ORTHO Home Defense Max Insect Killer Granules 2.5-lb Insect Killer in the Animal & Rodent Control department at Lowe's.com. The problem is, there are many different kinds of insects that are too hard to deal with individually. - San JoseSCORPIONSSILVERFISHSOWBUGSSPIDERS - Oriental It should not be touched if it hasnât dried yet, so you should keep your kids and pets away from the treatment while it is still drying. : 239-2633c pn: 6061 2. composition / information on ingredients 3. hazards identification emergency overview immediate concerns: causes moderate eye irritation avoid contact with eyes or clothing keep out of reach of children. Ortho Weed-B-Gone is a commonly used weed killer that kills more than 250 different varieties of broadleef weed without killing the surrounding grass. This product features a sprayer for application of ⦠However, the power of Ortho Home Defense Max seems to vary on different kinds of insects. - Bagworms skin contact is not toxic but ingestion is. Eliminator Insect Control active ingredient. Find helpful customer reviews and review ratings for Ortho Home Defense MAX Insect Killer for Indoor & Perimeter1 with Comfort Wand - Kills Ants, Cockroaches, Spiders, Fleas, Ticks & Other Listed Bugs, Creates a Bug Barrier, 1.1 gal. Text separated by I denotes and/or options.Highlighted+unde~ined text is new. - Corn Earworm - Green Fruitworm 25% (±) ⦠Donât just kill bugs; create a bug barrier with Ortho Home Defense MAX Insect Killer Granules. However, you are encouraged to repeat the application whenever necessary, especially if the treatment gets exposed to water or rain. Product Name on Label: Ortho home defense max termite and destructive bug killer The EPA Registered Name for this product is: Talstar 2.4% me insecticide/miticide This occurs when a single registered product is sold using many different names. - Red-Banded This is a synthetic pyrethroid. product name: ortho® home defense® max⢠ready-to-use insect killer product description: insecticide epa reg. Do no allow this product to contact water supplies. Use with confidence in kitchens, bathrooms and throughout the house to kill common indoor pests, with no staining or odors. Pet-safe: - Flea – Non-staining This is not the product label. - Pickleworm Whether you have ants, spiders, centipedes, or other - Crickets Set spray nozzle to indoor setting. 4. - Green Cloverworm Apply a 12 inch band along the exterior perimeter of your home in areas where insects are a recurring problem. ⢠Suitable for various kinds of insects skin contact is not toxic but ingestion is. away from you. Thank you for your question regarding Ortho Home Defense Max Insect Control. Active Ingredients is listed as 0.05% Bifenthrin (MSDS)- It is virtually insoluble in water so it has high persistence in soil (half life = 7 days â 8 months) and consequently it is one of the longest residual termiticide, which can be good or bad. - Armyworms (Beet, Fall, Southern, True, Yellow Striped, Beet Armyworm Eggs) Apply as a perimeter treatment along foundations. Ortho Home Defense Max Pull-N-Spray, 5 L Battery Powered $39. Kills carpenter ants, foraging fire ants, lawn ants, Argentine ants, pavement ants, pharaoh ants, pyramid ants, and red/western harvester ants. - Brown Marmorated It takes about 24 hours to dry properly; during this duration, it should be protected and undisturbed. - Pecan Leaf GHS product identifier : ORTHO HOME DEFENSE MAX INDOOR INSECT BARRIER Product type : Pesticide SDS # : 320000012123 EPA Registration Number: : 239-2699 . Ortho Home Defense MAX Insect Killer for Indoor & Perimeter1 with Comfort Wand easily kills indoor pests, including ants, cockroaches, spiders, fleas and ticks. If you are looking for an all-in-one solution for your homeâs insect issues, Ortho Home Defense Max is a great solution. Still, in most cases, it is able to repel them so that they donât get into your personal space. [Bracketed information is optional text]. – Bifenthrin: .05% 99 (30) View Wishlist Added to Wishlist Wilson Home Pest Control, 1-L $9. Ortho Home Defense comes in a half-gallon container with a battery-powered continuous spray wand. Read honest … Do not apply this product in or on electrical equipment due to the possibility of shock hazard. Developed by Rubel, Wagner Flexio 590 Review: The Complete Painting Solution. - Two Spotted Spider (Adult) - Painted Lady Unlike many bed bug sprays out there, it doesnât rely on pyrethroids alone. In this Ortho Home Defense Max review, we will take a look at a great solution for your homeâs insect issues. - Broad ortho home defense indoor & outdoor insect killer bifenthrin ; raid yard guard outdoor fogger formula vii permethrin ; nix lice treatmentpermethrin ; bayer lawn & garden multi-insect killer Simply snap open the traps and let the pre-loaded active liquid ingredients work their magic on that pesky colony and its queen. - Pyramid It should dry within a couple of hours of application, though the directions state that it could take as long as 6-8 hours before becoming fully safe to use. Ortho Home defense: From the Ortho site - it contains 2 ingredients Bifenthrin and Zeta Cypermethrin. - Redheaded PineSCALES Insect Killer for Indoor and Perimeter refill. - Elm Leaf Ready-to-Use Perimeter and Indoor Insect Killer is designed for interior and exterior use to kill ants, roaches, spiders and other pests and to help keep new ones from entering your home. - Imported Cabbageworm Loopers (Alfalfa, Cabbage, Celery) The combination is effective for targeting various kinds of insects, including the most common problems such as ants, cockroaches, fleas, earwigs, millipedes, spiders, ticks, and centipedes. Ortho Home Defense MAX Insect Killer for Indoor & Perimeter 1 kills ants, roaches and spiders indoors on nonporous surfaces. - KudzuSTORED PRODUCT PESTSTHRIPSTICKSTERMITESWASPSWHITEFLIESYELLOWJACKETS. away from you. Given that Ortho Home Defense is safe to be around after it dries, that begs the question of just how long it takes to properly dry. Kills Roaches, Ants and Spiders by Contact, Create a 12-Month Barrier for Ants, Roaches and Spiders: Spray on Indoor Non-Porous Surfaces, Create a 3-Month Barrier Against Outdoor Bugs - Apply as a Perimeter Treatment, Ortho® Home Defense Insect Killer For Indoor & Perimeter, For Refill, just plug in the Comfort Wand® and it's ready to spray, Up to 12-month protection (against ants, roaches and spiders indoors on nonporous surfaces), Kills all common listed household bugs (see product label for complete list of insects), Common Outdoor Bugs and How to Deal with Them, Controlling Pests on Flowers, Roses & Ornamental Plants. Is it really safe for cats and dogs? - Two Spotted Spider (Eggs) MOLE CRICKETSMOSQUITOESMOTHS In most cases, it is best to leave the treatment to dry for about 24 hours. How to use and dangers of Ortho Home Defense spray? - American/Palmetto Bug - Cutworms The active ingredient in this product is Permethrin, which will effect the nervous system causing paralysis. 1. Text separated by I denotes and/or options.Highlighted+unde~ined text is new. - GypsyPERIODICAL CICADAPHYLLOXERA There presently are only 2 ⦠- Tent - Pharaoh/Sugar - TarnishedPSYLLIDS It kills insects, including fleas, ticks, spiders and more, outside the home before they can come inside plus it starts creating a bug barrier in just minutes. - Eastern SprucegallANTS Whether you have ants, spiders, centipedes, or other - European Pine - Buckhorn World rights reserved. - Lady Beetles (including Asian Lady Beetle Eggs) On fabric and carpet, it leaves a dry residue for two weeks, so any bed bugs that come out of hiding and make contact with the chemicals should be killed. Spray until slightly wet, without soaking. - Spotted Cucumber / Southern Corn Rootworm (Adults) Ortho Home Defense and its active ingredients are EPA-registered and safe to use around for yourself, your kids, and pets such as cats and dogs. Spray a 12-inch barrier around perimeters and foundations for up to 3 months of control. In household concentrations pyrethroids are generally harmless to humans. Kills spiders including black widow, brown recluse, hobo, and wolf spiders. - Squash BugLEAFHOPPERSLEAFMINERS The Ortho® Guarantee: If for any reason you, the consumer, are not satisfied with this product, mail us your original proof of purchase to obtain a full refund of your purchase price. Ortho Home defense: From the Ortho site - it contains 2 ingredients Bifenthrin and Zeta Cypermethrin. My cat may have ingested a small amount of ORTHO Home Defense - Answered by a verified Cat Veterinarian We use cookies to give you the best possible experience on our website. Whether you have ants, spiders, roaches, or other home-invading insects as listed, you can count on Ortho® to keep them out. It is intended for both indoor and outdoor use and … Conclusion 2. Ortho Home Defense Indoor and Outdoor Insect Killer2 Identification GHS product identifier : ORTHO HOME DEFENSE MAX INSECT KILLER FOR INDOOR & PERIMETER 1 Product type : Pesticide SDS # : 320000005718 EPA Registration Number: : 279-9534-239 - Colorado Potato - Black Turfgrass Ataenius Need an answer to a product question? - Chigger 0.05% Bifenthrin 0.0125% Zeta-Cypermethrin. No. 99 (8) View Wishlist Added to Wishlist Wilson Home Pest Control Battery Powered Sprayer, 3-L Buy online and get it shipped to your door. Active ingredients in Ortho’s bed bug spray include: 4% Sumithrin. Active Ingredients: 0.20% Tetramethrin, 0.20% Phenothrin Ortho® Home Defense® Flying Insect Killer kills listed insects both indoors and out. - StalkBOXELDER BUGSBRISTLETAILSCATERPILLARS Donât just kill bugs; create a bug barrier with Ortho® Home Defense® Insect Killer for Indoor & Perimeter Refill2. This insecticide is also able to keep those nasty insects at bay. - VegetableLEAFROLLERS One of the most annoying problems that a home can have is insect infestation. Hello, I am spraying for the first time ever. - HouseFUNGUS GNATSGRASSHOPPERSHORNETSLACE BUGSLEAFFOOTED BUGS Invest in insect control that works. Ortho Ant B Gon Max Ant Killer Bait (6-Pack) Give ants their marching orders with new Ortho Ant B Gon Ant Killer Bait. 239-2699 Bold, italicized text Is Information for the reader and Is not part of the label. - Filbertworm I know to spray around the entrances and crevices around walls..but I would like some more direction on safety. Ortho Home defense spray (insecticide) says on the label that it is safe for pets and children once the spray is dry. Ortho Home Defense. INDOORS: Do not spray into air. “For long lasting residual control leave spray undisturbed. Active Ingredients: 0.20% Tetramethrin, 0.20% Phenothrin Ortho® Home Defense® Flying Insect Killer kills listed insects both indoors and out. With this very spray, you will be able to eliminate more than 130 different kinds of insects. Now i am wondering if i should try to mop it up, or if it is truly okay for my pets. - Billbugs Ortho® Home Defense Insect Killer for Indoor & Perimeter with Comfort Wand® delivers a potent bug barrier. Simply plug in the Comfort Wand, and with one touch you can kill and protect against pests. Do not spray animals. - Cranberry Fruitworm Outdoors, it can be used on ornamental plants to control insects including aphids, white flies and Japanese Beetles. - Brown Soft - WalnutBEESBEETLES - Apple Maggot Eliminator is only $5/gallon, but I was purchasing the Ortho last year from Walmart for $5/gallon. - Carpenter For more help, visit our Help Center. at Amazon.com. The Ortho Group P.O. It kills eggs, nymphs, and adult bed bugs, including ones that are pyrethroid-resistant. - Waterbug - PearSAWFLIES It should dry within a couple of hours of application, though the directions state that it could take as long as 6-8 hours before becoming fully safe to use. By continuing to use this site you consent to the use of cookies on your device as described in our cookie policy unless you have disabled them. 3. Safety Data Sheets can be found at scottsmsds.com. Apply a 4-inch barrier around baseboards, cabinets, and windows. Ortho Home Defense Max has a formula that combines a 0.05 percent concentration of bifenthrin, the active ingredient, with 0.0125 percent concentration of the inactive ingredient, zeta-cypermethrin. Active Ingredient: - Spruce No. Apply indoor or outdoors according to label instructions. I have already sprayed most of the house, and have left my animals locked up in a separate room of the house. Ortho Home Defense Insect Killer for Lawns Granules provides 3-months of protection* from bugs for you and your family. Ortho Home Defense Insect Killer for Lawns Granules provides 3-months of protection (refer to back panel for insects controlled for 3 months) from bugs for you and your family. So - best recommendation - spray when the air is still - ⦠- German Purpose of product. 4. - Black Widow - Hobo - Pine Chafer (grub) Ortho Home Defense MAX Insect Killer Indoor & Perimeter with Comfort Wand is specially formulated to help prevent and control home invading insects for up to 12 months. Once it has dried, the area is safe for kids and pets. Bifenthrin 0.05. - SouthernCOCKROACHES Read honest and unbiased product reviews from our ⦠Organic treatments: Eco-Defense makes an organic and natural spray, which is safe around children and pets. Active ingredients in Orthoâs bed bug spray include: 4% Sumithrin. 5. Available at your local TSC Store! Ortho Home defense: From the Ortho site - it contains 2 ingredients Bifenthrin and Zeta Cypermethrin. Don’t just kill bugs; create a bug barrier with Ortho Home Defense MAX Insect Killer Granules. - Alder - Japanese (Adults) To Kill and To Repel – Residential (Indoors & Outdoors), Family Rooms, Bathrooms, Bedrooms, Kitchens, Pantries, Garages, Basements, Attics, Closets, Storage Areas, Perimeter Foundations, Doors and Windows, Patios and Decks Ortho Home Defense Max Indoor & Perimeter Insect Killer2 Ortho® Home Defense Max Home Insect Killer2 ... Other Ingredients: 99.9375% 100.0000% 1 Cis isomers 97% min, trans isomers 3% max 2 Cis/trans ratio: Max. - Pecan Nut Casebearer - Saltmarsh Kills 130+ other insects including stink bugs, beetles, earwigs, fleas, house centipedes, millipedes, scorpions, silverfish, and ticks. - Red/Western HarvesterAPHIDS - Hornworms (Tobacco & Tomato) Hold sprayer 12 inches from surfaces being sprayed. 99 (8) View Wishlist Added to Wishlist Wilson Home Pest ⦠Talstar will typically give 60 to 90 days. - Hairy - European Corn - FirebratsFLEAS KILLS: ADELGIDS It is suitable for indoors and outdoors. 1. This insecticide is also able to keep those nasty insects at bay. - Lygus Bug - Pavement - Codling Use with confidence in kitchens, bathrooms and throughout the house to kill common indoor pests, with no staining or odors. - European Crane (Adult) It kills insects, including fleas, ticks, spiders and more, outside the home before they can come inside plus it starts creating a bug barrier in just minutes. However, please don’t use it around aquatic life like fish. – Zeta-Cypermethrin: .0125% - Oblique Banded Talstar contains 7. Create a bug barrier with - Black Cherry – Dries fast Ortho will probably realistically only give you 30 days of protection. You can try to touch it with a finger to see if it has dried yet. It uses Bifenthrin as its active ingredient which effectively kill insect pests like ants, cockroaches, centipedes, earwigs, fleas, ticks, millipedes, silverfish, spiders, and other listed insects. Copyright © 2020 Homeverity.com. – Ants, Centipedes, Cockroaches, Earwigs, Fleas, Millipedes, Scorpions, Silverfish, Spiders, Ticks and others *(see the label for a complete list) skin contact is not toxic but ingestion is. - VelvetbeanCENTIPEDESCHINCH BUGS In the house, it can be used to control insects including flies, gnats and mosquitoes. However, note that it needs to be applied on a dry area. For Indoors and Outdoors 99 (17) View Wishlist Added to Wishlist Ortho Home Defense Max Ant Eliminator, 709-mL $9. Ortho Home Defense Insect Killer for Indoor & Perimeter Refill 2 Don't just kill bugs; create a bug barrier Don't just kill bugs; create a bug barrier with Ortho Home Defense MAX. Thatâs where Ortho Home Defense Max may help. And on the other hand, the Ortho Home Defense is bifenthrin concentrated chemical that strongly works against keeping most of the insects such as roaches, ants, spiders, etc. My cat may have ingested a small amount of ORTHO Home Defense - Answered by a verified Cat Veterinarian We use cookies to give you the best possible experience on our website. - Biting Flies - DogFLIES Apply a 4-inch barrier around window trim and door trim. 05% Imidacloprid. Is Ortho Home Defense kid and pet safe? Shake well. - Pine Shoot both have low toxicity towards mammals (humans). - Clover Do not apply this product, or allow it to drift, to blooming plants if bees are visiting the treatment area. It kills insects, including fleas, ticks, spiders and more, outside the home before they can come inside plus it starts creating a bug barrier in just … – Spray until slightly wet, without soaking - California Red ⢠Safe for kids and pets after 24 hours. Shipping Weight: NOTE: EPA Reg. - Tentiform Special Features: - Greenbug Once it has dried though, it can last for a long while. - Corn Rootworm (Adults) If you have any further questions or would like further assistance, please contact us at 877-220-3089 and one of our representatives would be glad to assist you. Whether you have ants, spiders, roaches or other home-invading insects, you can count on Ortho Home Defense to keep them out. Application: - Foraging Fire Ants 75% (±) cis and min. Hold sprayer 12 inches from surfaces being sprayed. Apply a 4 inch band along the interior of your home in areas where insects are a recurring problem. Bifenthrin 0.05. People and pets may enter treated areas after spray has dried. Ortho Home Defense comes in a half-gallon container with a battery-powered continuous spray wand. The Eco Defense Organic Home Pest Control Spray is made with safe, all-natural ingredients. The manufacturer claims that it is safe if used according to the label. 05 % bifenthrin. Deltamethrin 0.02%. - Artichoke Plume - Diamondback Whether you have ants, spiders, roaches or other home-invading insects, you can count on Ortho to keep them out. Find helpful customer reviews and review ratings for Ortho Home Defense MAX Insect Killer for Indoor & Perimeter1 with Comfort Wand - Kills Ants, Cockroaches, Spiders, Fleas, Ticks & Other Listed Bugs, Creates a Bug Barrier, 1.1 gal. at Amazon.com. 1. Ortho Home Defense Max is able to kill insects that get in contact with it. Outdoors, it can be used on ornamental plants to control insects including aphids, white flies and Japanese Beetles. Identification . - Asian Its active ingredients are Sodium Lauryl Sulfate (= SLS) together with geranium oil and peppermint oil. It uses two active ingredients, which are bifenthrin 0.05% and zeta-cypermethrin 0.0125%. - Peachtree Ortho Home Defense Insect Killer for Lawns Granules provides 3-months of protection* from bugs for you and your family. The Scotts Company, LLC, manufactures Ortho products, while Chemisco, a division of United Industries Corporation, makes Spectracide products. Identification . - Peach Twig - Euonymus Ortho Home defense spray (insecticide) says on the label that it is safe for pets and children once the spray is dry. - Cat Usage: ... chemicals associated with products in this database may be viewed by selecting the "Advanced" button on the Chemical Ingredients tables. - WolfSPITTLEBUGS © 2020 The Scotts Company LLC. Active Ingredients is listed as 0.05% Bifenthrin (MSDS)- It is virtually insoluble in water so it has high persistence in soil (half life = 7 days – 8 months) and consequently it is one of the longest residual termiticide, which can be good or bad. - Pecan Apply a 4-inch barrier around wall perimeters, washers, and driers. - Rosy Apple Deltamethrin 0.02%. It uses two active ingredients, which are bifenthrin 0.05% and zeta-cypermethrin 0.0125%. According to the manufacturer, Ortho Home Defense Max can last for about 12 months if left undisturbed. Eliminator Insect Control active ingredient. Spray a 12-inch barrier around patio and deck perimeters for up to 3 months of control. - Blueberry Spanworm - Brown Recluse Usage: ... chemicals associated with products in this database may be viewed by selecting the "Advanced" button on the Chemical Ingredients tables. While it will control all stages of bed bugs, it will not control all stages of fleas, tickets or other insects listed. - Curculio (Cow Pea, Plum) It kills eggs, nymphs, and adult bed bugs, including ones that are pyrethroid-resistant. - Lesser Peachtree - Pea Ortho Home Defense MAX Insect Killer for Indoor & Perimeter1 with Comfort Wand easily kills indoor pests, including ants, cockroaches, spiders, fleas and ticks. - Cherry Fruit A detailed review of the Ortho Home Defense Indoor & Outdoor Insect & Roach Killer along with our in Roach Sprays Buying Guide. Donât just kill bugs; create a bug barrier with Ortho® Home Defense® Insect Killer for Indoor & Perimeter Refill2. ORTHO HOME DEFENSE MAX INDOOR INSECT BARRIER . Set spray nozzle to outdoor setting. There presently are … - Striped Cucumber Weevils (Annual Bluegrass & Black Vine) BORERS both have low toxicity towards mammals (humans). Invest in insect control that works. People and pets may re-enter the treated area after spray has dried. So - best recommendation - spray when the air is still - … Zeta-Cypermethrin 0.0125. - Rose Scotts experts are always available by email and phone in our Help Center. - Navel Orangeworm Apply a 4-inch barrier around baseboards, tubs, and cabinets. In general, it is more powerful for dealing with the smaller insects and less powerful for the bigger ones. Areas after spray has dried follow the product label before use the active ingredients, which effect... Be used to control insects including flies, gnats and mosquitoes to leave the treatment area if undisturbed! Max kills bugs inside, keeps bugs out is intended for both and... Made with safe, all-natural ingredients bug sprays out there, it will not control all of... Months if left undisturbed on pyrethroids alone separated by I denotes and/or options.Highlighted+unde~ined text is.... There, it can be used on ornamental plants to control insects including aphids, white flies and Japanese.! And Japanese Beetles intended for both Indoor and Outdoor use and dangers of Home. Tubs, and adult bed bugs, it should ortho home defense ingredients protected and undisturbed, tubs, and website this... Ortho last year from Walmart for $ 5/gallon, but I would like some more direction safety! Around perimeters and foundations for up to 3 months of control which is safe kids. Pretty long to dry, but I was purchasing the Ortho ortho home defense ingredients - it contains 2 ingredients and! Simply snap open the traps and let the pre-loaded active liquid ingredients work their on! Out there, it can be used on ornamental plants to control insects including,! 5 L Battery Powered $ 39 get it shipped to your door, palmetto bugs, ones! Is, there are many different kinds of insects 1 kills ants, roaches or other insects listed to applied. Buying Guide ingredients, which are Bifenthrin 0.05 % and zeta-cypermethrin 0.0125 % we will a... … NOTE: EPA Reg drift, to blooming plants if bees are visiting treatment... Is dry will be ⦠the bottom line is bed ortho home defense ingredients, bugs! Spiders including black widow, brown recluse, hobo, and with one touch can... This Ortho Home Defense Insect Killer Granules 2.5-lb Insect Killer in the Animal & Rodent control department at Lowe's.com undisturbed. And its queen that are pyrethroid-resistant with the smaller insects and less powerful for the bigger ones they. That you wash your hands after using or touching Ortho Home Defense Max is a great for! It around aquatic life like fish crevices and … NOTE: EPA Reg you! Walmart for $ 5/gallon, but I ortho home defense ingredients like some more direction on safety nervous.. Protected and undisturbed Lawns Granules provides 3-months of protection out there, it be! And let the pre-loaded active liquid ingredients work their magic on that pesky colony its! Rodent control department at Lowe's.com re-enter the treated area after spray has dried will be to. Is best to leave the treatment gets exposed to water or rain first time ever ⦠Organic:! For an all-in-one solution for your homeâs Insect issues it around aquatic life like fish a half-gallon with! Was purchasing the Ortho Home Defense spray ( insecticide ) says on the label bees are visiting the gets. Bed bug spray include: 4 % Sumithrin kill bugs ; create a bug barrier Ortho... That they donât get into your personal space and unbiased product reviews from our ⦠NOTE: EPA Reg it... Of fleas, tickets or other home-invading insects, you are encouraged repeat! Perimeter Refill2 can count on Ortho Home Defense Max Insect Killer for &! Allow this product is Permethrin, which are Bifenthrin 0.05 % and zeta-cypermethrin 0.0125.... Spiders including black widow, brown recluse, hobo, and adult bed arenât. The nervous system 4 inch band along the interior of your Home areas! 0.0125 % lasting residual control leave spray undisturbed be able to keep them out and. Door entrances and crevices around walls.. but I was purchasing the Ortho Home Defense text by. Count on Ortho to keep those nasty insects at bay thatâs exactly why Home. Ortho 220910 Home Defense Max 1.33 Gal product is Permethrin, which will effect the nervous system paralysis! And spiders indoors on nonporous surfaces the application whenever necessary, especially if the treatment gets to! Is a great solution for your homeâs Insect issues eliminator is only $ 5/gallon our in sprays! Rubel, Wagner Flexio 590 review: the Complete Painting solution along the exterior Perimeter of your Home areas., or allow it to drift, to blooming plants if bees are visiting the treatment area now I wondering. Kills the eggs, meaning you can count on Ortho ortho home defense ingredients keep those nasty insects at bay long! Perimeters for up to 3 months of control it directly onto nests into... Rely on pyrethroids alone bug barrier EPA Reg manufacturer, Ortho Home Defense Max 1.33 Gal Defense to keep out... Comes in a half-gallon container with a battery-powered continuous spray wand dry for about 12 months left. Around the entrances and walls for up to 3 months of control hello I... With a finger to see if it is safe for kids and pets spray ( insecticide says! Animal & Rodent control department at Lowe's.com you wash your hands after using or touching Ortho Defense! Denotes and/or options.Highlighted+unde~ined text is Information for the bigger ones at bay them out our! View Wishlist Added to Wishlist Ortho Home Defense Max kills bugs inside, keeps bugs out and indoors! Spiders indoors on nonporous surfaces count on Ortho to keep those nasty insects at bay to. Pull-N-Spray, 5 L Battery Powered $ 39 more powerful for dealing the... 130 different kinds of insects presently are … active ingredients in the Ortho last year from Walmart $. Max bed bug sprays out there, it can be used on ornamental plants control! Tickets or other home-invading insects, you will be ⦠the Ortho site - contains... Regarding Ortho Home Defense Max Insect Killer Granules for pets and children once spray...